PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01036037001
Common NameLOC100246796, VIT_04s0008g07340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CO-like
Protein Properties Length: 308aa    MW: 33424.4 Da    PI: 7.8549
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01036037001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.43e-08436436
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                       + C+ +++ + +lfC+ ++ +lC  C ++ H  
  GSVIVT01036037001  4 KLCDSCKSAPPTLFCRADSAFLCVACDSKVHAA 36
                       68***************************9954 PP

2zf-B_box27.75.5e-094691342
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                        ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  GSVIVT01036037001 46 VWMCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPV 91
                       689*****************************66899999*99986 PP

3CCT70.34.9e-24240284145
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                        Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  GSVIVT01036037001 240 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSE 284
                        9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.509148IPR000315B-box-type zinc finger
SMARTSM003363.5E-14148IPR000315B-box-type zinc finger
PfamPF006431.8E-6443IPR000315B-box-type zinc finger
CDDcd000218.38E-10548No hitNo description
PROSITE profilePS5011910.8934491IPR000315B-box-type zinc finger
PfamPF006432.7E-74691IPR000315B-box-type zinc finger
CDDcd000211.69E-94791No hitNo description
SMARTSM003361.3E-104991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787240282IPR010402CCT domain
PfamPF062034.3E-18240282IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MASKLCDSCK SAPPTLFCRA DSAFLCVACD SKVHAANKLA SRHARVWMCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLARRHERVP VVPFYDSAAA AAKSNAVNLL LAESSDLNSS  120
HYMFSDIDPY LDLDYPSMDP KLQSQQQQQS SGTDGVVPVQ NKSVQAPLVN DNCFDMDFSG  180
SKSFYNGQSL SQSVSSSSLE VGVVPDGNAM VDVTNPFGRS MNTGSESANQ TAQISSGIDR  240
EARVLRYREK RKNRKFEKTI RYASRKAYAE TRPRIKGRFA KRSEIEVDYS SSGALTADSG  300
YGVVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.44320.0bud| cell culture| flower| fruit| inflorescence| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3928690.0FQ392869.1 Vitis vinifera clone SS0AFA3YO03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263458.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-129COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLF6H3L90.0F6H3L9_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g07340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.14e-93CONSTANS-like 3